PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim11g011770.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 463aa    MW: 51751.1 Da    PI: 7.599
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim11g011770.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.6e-32267320255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Sopim11g011770.0.1 267 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 320
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.69E-15264320IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28265320IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-23267320IPR006447Myb domain, plants
PfamPF002498.6E-7268319IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MPLEGVFIET PSSSTKQIPD LSLNISPPTS LDLSGRRCVT EVSENHERLL PEFSKTGNCL  60
TELSLAHPTN ITTTTTTTIA NTNTVINDDT TTRRGFLDHL PRNPYYNNHH YQHQYQHQHQ  120
SQNYSHLVQP MNQINHGVSS LDVSDGLRPI KGIPVYNHNR SFPFLATNID KEKDPKMCFY  180
PSSSPPPSSS PSPSSPSPYF NNMFNGISSS SYHHVPHHHP LQYHHHHHSQ YGHLIHNSHH  240
ENIANSHSLM RSRFLPKLPA KRSMRAPRMR WTSTLHARFV HAVELLGGHE RATPKSVLEL  300
MDVKDLTLAH VKSHLQMYRT VKTTDKPAVS SGQSDGSGED DLTTIGSTGG GDRAGLGRFM  360
DQRGGSDGSL QPEPDYPSTA TNTLWSNSSS SREGWLQANS NDANVLMRSH SFPSQQRSSH  420
QIEECNSSKP KSYNIGSNLD HQKNPSLEFT LGRPDWIEKD HE*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755230.0HG975523.1 Solanum lycopersicum chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004250231.10.0PREDICTED: transcription repressor KAN1 isoform X1
SwissprotQ93WJ92e-69KAN1_ARATH; Transcription repressor KAN1
TrEMBLK4D5Y20.0K4D5Y2_SOLLC; Uncharacterized protein
STRINGSolyc11g011770.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24682355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.13e-59G2-like family protein